Recombinant Human HOXB7 Protein, GST-tagged
| Cat.No. : | HOXB7-4966H |
| Product Overview : | Human HOXB7 full-length ORF ( AAH15345.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq |
| Molecular Mass : | 50.4 kDa |
| AA Sequence : | MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HOXB7 homeobox B7 [ Homo sapiens ] |
| Official Symbol | HOXB7 |
| Synonyms | HOXB7; homeobox B7; homeo box B7 , HOX2, HOX2C; homeobox protein Hox-B7; homeo box 2C; homeo box B7; homeo box c1 protein; homeobox protein HHO.C1; homeobox protein Hox-2C; HOX2; HOX2C; HHO.C1; Hox-2.3; |
| Gene ID | 3217 |
| mRNA Refseq | NM_004502 |
| Protein Refseq | NP_004493 |
| MIM | 142962 |
| UniProt ID | P09629 |
| ◆ Recombinant Proteins | ||
| HOXB7-4966H | Recombinant Human HOXB7 Protein, GST-tagged | +Inquiry |
| HOXB7-1590H | Recombinant Human HOXB7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Hoxb7-1157M | Recombinant Mouse Hoxb7 Protein, MYC/DDK-tagged | +Inquiry |
| HOXB7-13900H | Recombinant Human HOXB7, GST-tagged | +Inquiry |
| HOXB7-4286M | Recombinant Mouse HOXB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HOXB7-811HCL | Recombinant Human HOXB7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXB7 Products
Required fields are marked with *
My Review for All HOXB7 Products
Required fields are marked with *
