Recombinant Human HOXB7 Protein, GST-tagged

Cat.No. : HOXB7-4966H
Product Overview : Human HOXB7 full-length ORF ( AAH15345.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq
Molecular Mass : 50.4 kDa
AA Sequence : MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXB7 homeobox B7 [ Homo sapiens ]
Official Symbol HOXB7
Synonyms HOXB7; homeobox B7; homeo box B7 , HOX2, HOX2C; homeobox protein Hox-B7; homeo box 2C; homeo box B7; homeo box c1 protein; homeobox protein HHO.C1; homeobox protein Hox-2C; HOX2; HOX2C; HHO.C1; Hox-2.3;
Gene ID 3217
mRNA Refseq NM_004502
Protein Refseq NP_004493
MIM 142962
UniProt ID P09629

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB7 Products

Required fields are marked with *

My Review for All HOXB7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon