Recombinant Human HOXB9 Protein, GST-tagged
Cat.No. : | HOXB9-4970H |
Product Overview : | Human HOXB9 full-length ORF ( NP_076922.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXB9 homeobox B9 [ Homo sapiens ] |
Official Symbol | HOXB9 |
Synonyms | HOXB9; homeobox B9; homeo box B9 , HOX2, HOX2E; homeobox protein Hox-B9; homeo box 2E; homeo box B9; homeobox protein Hox-2E; homeobox protein Hox-2.5; HOX2; HOX2E; HOX-2.5; |
Gene ID | 3219 |
mRNA Refseq | NM_024017 |
Protein Refseq | NP_076922 |
MIM | 142964 |
UniProt ID | P17482 |
◆ Recombinant Proteins | ||
HOXB9-3722HF | Recombinant Full Length Human HOXB9 Protein, GST-tagged | +Inquiry |
HOXB9-13901H | Recombinant Human HOXB9, GST-tagged | +Inquiry |
HOXB9-4287M | Recombinant Mouse HOXB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXB9-4970H | Recombinant Human HOXB9 Protein, GST-tagged | +Inquiry |
HOXB9-7803M | Recombinant Mouse HOXB9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXB9-812HCL | Recombinant Human HOXB9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXB9 Products
Required fields are marked with *
My Review for All HOXB9 Products
Required fields are marked with *
0
Inquiry Basket