Recombinant Human HOXC5 Protein, GST-tagged
Cat.No. : | HOXC5-4981H |
Product Overview : | Human HOXC5 full-length ORF ( NP_061826.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5 non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesnt encode a protein. The protein-coding transcript variant contains gene-specific exons only. [provided by RefSeq |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXC5 homeobox C5 [ Homo sapiens ] |
Official Symbol | HOXC5 |
Synonyms | HOXC5; homeobox C5; homeo box C5 , HOX3, HOX3D; homeobox protein Hox-C5; homeo box C5; homeobox protein CP11; homeobox protein Hox-3D; CP11; HOX3; HOX3D; |
Gene ID | 3222 |
mRNA Refseq | NM_018953 |
Protein Refseq | NP_061826 |
MIM | 142973 |
UniProt ID | Q00444 |
◆ Recombinant Proteins | ||
HOXC5-4293M | Recombinant Mouse HOXC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXC5-29379TH | Recombinant Human HOXC5 | +Inquiry |
HOXC5-066H | Recombinant Human HOXC5 Protein, HIS-tagged | +Inquiry |
HOXC5-4981H | Recombinant Human HOXC5 Protein, GST-tagged | +Inquiry |
HOXC5-3727HF | Recombinant Full Length Human HOXC5 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC5 Products
Required fields are marked with *
My Review for All HOXC5 Products
Required fields are marked with *