Recombinant Human HOXD4 Protein, GST-tagged
Cat.No. : | HOXD4-4997H |
Product Overview : | Human HOXD4 full-length ORF ( NP_055436.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5 end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq |
Molecular Mass : | 54.3 kDa |
AA Sequence : | MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXD4 homeobox D4 [ Homo sapiens ] |
Official Symbol | HOXD4 |
Synonyms | HOXD4; homeobox D4; homeo box D4 , HOX4, HOX4B; homeobox protein Hox-D4; homeobox protein Hox-4B; homeobox protein HHO.C13; homeobox protein Hox-5.1; Hox-4.2, mouse, homolog of homeo box X; HOX4; HOX4B; HHO.C13; HOX-5.1; Hox-4.2; |
Gene ID | 3233 |
mRNA Refseq | NM_014621 |
Protein Refseq | NP_055436 |
UniProt ID | P09016 |
◆ Recombinant Proteins | ||
HOXD4-4299M | Recombinant Mouse HOXD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXD4-13914H | Recombinant Human HOXD4, His-tagged | +Inquiry |
HOXD4-4997H | Recombinant Human HOXD4 Protein, GST-tagged | +Inquiry |
HOXD4-26695TH | Recombinant Human HOXD4 | +Inquiry |
HOXD4-1888C | Recombinant Chicken HOXD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HOXD4-5411HCL | Recombinant Human HOXD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXD4 Products
Required fields are marked with *
My Review for All HOXD4 Products
Required fields are marked with *
0
Inquiry Basket