Recombinant Human HP protein
Cat.No. : | HP-3049H |
Product Overview : | Recombinant Human HP protein(P00738)(19-406aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 19-406aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HP haptoglobin [ Homo sapiens ] |
Official Symbol | HP |
Synonyms | HP; haptoglobin; zonulin; binding peptide; haptoglobin alpha(1S)-beta; haptoglobin alpha(2FS)-beta; haptoglobin, beta polypeptide; haptoglobin, alpha polypeptide; BP; HPA1S; HP2ALPHA2; MGC111141; |
Gene ID | 3240 |
mRNA Refseq | NM_001126102 |
Protein Refseq | NP_001119574 |
MIM | 140100 |
UniProt ID | P00738 |
◆ Recombinant Proteins | ||
HP-7760R | Recombinant Rabbit HP protein, His & T7-tagged | +Inquiry |
HP-5101H | Recombinant Human HP, His-tagged | +Inquiry |
Hp-4644M | Recombinant Mouse Hp protein, His-tagged | +Inquiry |
HP-1093H | Recombinant Human HP Protein, His (Fc)-Avi-tagged | +Inquiry |
HP-7751C | Recombinant Cattle HP protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Hp-194R | Native Rat Haptoglobin | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
HP-133B | Native Bovine Haptoglobin | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HP-5408HCL | Recombinant Human HP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HP Products
Required fields are marked with *
My Review for All HP Products
Required fields are marked with *
0
Inquiry Basket