Recombinant Human HPCA protein, His-tagged
Cat.No. : | HPCA-3879H |
Product Overview : | Recombinant Human HPCA protein(1-193 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-193 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HPCA hippocalcin [ Homo sapiens ] |
Official Symbol | HPCA |
Synonyms | HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2; |
Gene ID | 3208 |
mRNA Refseq | NM_002143 |
Protein Refseq | NP_002134 |
MIM | 142622 |
UniProt ID | P84074 |
◆ Recombinant Proteins | ||
HPCA-1957R | Recombinant Rhesus Macaque HPCA Protein, His (Fc)-Avi-tagged | +Inquiry |
HPCA-329H | Recombinant Human HPCA protein(2-193aa), His&Myc-tagged | +Inquiry |
HPCA-3879H | Recombinant Human HPCA protein, His-tagged | +Inquiry |
HPCA-7824M | Recombinant Mouse HPCA Protein | +Inquiry |
HPCA-1742H | Recombinant Human HPCA protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPCA-815HCL | Recombinant Human HPCA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPCA Products
Required fields are marked with *
My Review for All HPCA Products
Required fields are marked with *