Recombinant Human HPCA protein, His-tagged
| Cat.No. : | HPCA-3879H |
| Product Overview : | Recombinant Human HPCA protein(1-193 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-193 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HPCA hippocalcin [ Homo sapiens ] |
| Official Symbol | HPCA |
| Synonyms | HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2; |
| Gene ID | 3208 |
| mRNA Refseq | NM_002143 |
| Protein Refseq | NP_002134 |
| MIM | 142622 |
| UniProt ID | P84074 |
| ◆ Recombinant Proteins | ||
| HPCA-3086H | Recombinant Human HPCA Protein (Gly2-Phe193), N-His tagged | +Inquiry |
| HPCA-3617HF | Recombinant Full Length Human HPCA Protein, GST-tagged | +Inquiry |
| HPCA-5003H | Recombinant Human HPCA Protein, GST-tagged | +Inquiry |
| HPCA-7824M | Recombinant Mouse HPCA Protein | +Inquiry |
| HPCA-3879H | Recombinant Human HPCA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPCA-815HCL | Recombinant Human HPCA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPCA Products
Required fields are marked with *
My Review for All HPCA Products
Required fields are marked with *



