Recombinant Human HPRT1 protein, His-tagged
| Cat.No. : | HPRT1-5126H |
| Product Overview : | Recombinant Human HPRT1 protein(P00492)(MHHHHHHKWFKIQMQIRRWKNKRAEEQQPWAQYLELLFPTETLLLEWGGGGGSGFLGPAPAPAPAPA+2-218aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | MHHHHHHKWFKIQMQIRRWKNKRAEEQQPWAQYLELLFPTETLLLEWGGGGGSGFLGPAPAPAPAPA+2-218aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA |
| Gene Name | HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens ] |
| Official Symbol | HPRT1 |
| Synonyms | HPRT1; hypoxanthine phosphoribosyltransferase 1; HPRT; hypoxanthine-guanine phosphoribosyltransferase; HGPRT; Lesch Nyhan syndrome; HGPRTase; |
| Gene ID | 3251 |
| mRNA Refseq | NM_000194 |
| Protein Refseq | NP_000185 |
| MIM | 308000 |
| UniProt ID | P00492 |
| ◆ Recombinant Proteins | ||
| HPRT1-619HFL | Recombinant Full Length Human HPRT1 Protein, C-Flag-tagged | +Inquiry |
| HPRT1-949H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
| HPRT1-950H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
| HPRT1-3434H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
| HPRT1-2560R | Recombinant Rat HPRT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPRT1-5398HCL | Recombinant Human HPRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPRT1 Products
Required fields are marked with *
My Review for All HPRT1 Products
Required fields are marked with *
