"HPSE2" Related Products

Recombinant Human HPSE2 Protein, His-tagged

Cat.No.: HPSE2-1037H
Product Overview: Recombinant Human HPSE2 protein (41-592) was expressed in HEK 293 cells with C-terminal His tag.
Source: HEK293
Species: Human
Tag : His
Form: PBS, 10% Glycerol.
Molecular Mass: 64 kDa
AA Sequence: AGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGC
KIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKS
LLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLAN
QGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLK
SKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYRGGGCCPGCCGGSGHHHHHHHHHH
Storage: The protein should be stored at -20 centigrade to -70 centigrade preferably in small aliquots to avoid repeated freeze-thaw cycles.
Gene Name: HPSE2 heparanase 2 (inactive) [ Homo sapiens (human) ]
Official Symbol: HPSE2
Synonyms: UFS; HPA2; HPR2; UFS1
Gene ID: 60495
mRNA Refseq: NM_021828.4
Protein Refseq: NP_068600.4
MIM: 613469
UniProt ID: Q8WWQ2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.