"HPSE2" Related Products

Recombinant Human HPSE2 Protein, His-tagged

Cat.No. : HPSE2-1037H
Product Overview : Recombinant Human HPSE2 protein (41-592) was expressed in HEK 293 cells with C-terminal His tag.
Source : HEK293
Species : Human
Tag : His
Form : PBS, 10% Glycerol.
Molecular Mass : 64 kDa
AA Sequence : AGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGC
KIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKS
LLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLAN
QGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLK
SKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYRGGGCCPGCCGGSGHHHHHHHHHH
Storage : The protein should be stored at -20 centigrade to -70 centigrade preferably in small aliquots to avoid repeated freeze-thaw cycles.
Gene Name : HPSE2 heparanase 2 (inactive) [ Homo sapiens (human) ]
Official Symbol : HPSE2
Synonyms : UFS; HPA2; HPR2; UFS1
Gene ID : 60495
mRNA Refseq : NM_021828.4
Protein Refseq : NP_068600.4
MIM : 613469
UniProt ID : Q8WWQ2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.