Recombinant Human HPSE2 Protein, His-tagged
| Cat.No. : | HPSE2-1037H |
| Product Overview : | Recombinant Human HPSE2 protein (41-592) was expressed in HEK 293 cells with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 41-592 a.a. |
| Form : | PBS, 10% Glycerol. |
| Molecular Mass : | 64 kDa |
| AA Sequence : | AGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGC KIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKS LLQPIRIYSRASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLAN QGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLK SKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYRGGGCCPGCCGGSGHHHHHHHHHH |
| Storage : | The protein should be stored at -20 centigrade to -70 centigrade preferably in small aliquots to avoid repeated freeze-thaw cycles. |
| Gene Name | HPSE2 heparanase 2 (inactive) [ Homo sapiens (human) ] |
| Official Symbol | HPSE2 |
| Synonyms | UFS; HPA2; HPR2; UFS1 |
| Gene ID | 60495 |
| mRNA Refseq | NM_021828.4 |
| Protein Refseq | NP_068600.4 |
| MIM | 613469 |
| UniProt ID | Q8WWQ2 |
| ◆ Recombinant Proteins | ||
| HPSE2-1037H | Recombinant Human HPSE2 Protein, His-tagged | +Inquiry |
| HPSE2-7839M | Recombinant Mouse HPSE2 Protein | +Inquiry |
| HPSE2-5020H | Recombinant Human HPSE2 Protein, GST-tagged | +Inquiry |
| HPSE2-3638HF | Recombinant Full Length Human HPSE2 Protein, GST-tagged | +Inquiry |
| HPSE2-4312M | Recombinant Mouse HPSE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPSE2 Products
Required fields are marked with *
My Review for All HPSE2 Products
Required fields are marked with *
