Recombinant Human HRAS protein, His-tagged
| Cat.No. : | HRAS-13934H |
| Product Overview : | Recombinant Human HRAS protein(1-170 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | February 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-170 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSSSSSGTLWDPPGPM |
| Gene Name | HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | HRAS |
| Synonyms | HRAS; v-Ha-ras Harvey rat sarcoma viral oncogene homolog; HRAS1; GTPase HRas; p21ras; H-Ras-1; p19 H-RasIDX protein; c-has/bas p21 protein; transforming protein p21; Ha-Ras1 proto-oncoprotein; c-ras-Ki-2 activated oncogene; GTP- and GDP-binding peptide B; transformation gene: oncogene HAMSV; Ras family small GTP binding protein H-Ras; CTLO; HAMSV; K-RAS; N-RAS; RASH1; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; |
| Gene ID | 3265 |
| mRNA Refseq | NM_001130442 |
| Protein Refseq | NP_001123914 |
| MIM | 190020 |
| UniProt ID | P01112 |
| ◆ Recombinant Proteins | ||
| ABCC3-2466H | Recombinant Human ABCC3 protein(871-950 aa), C-His-tagged | +Inquiry |
| HRAS-13934H | Recombinant Human HRAS protein, His-tagged | +Inquiry |
| ABCC3-0440H | Recombinant Human ABCC3 Protein (Phe1291-Asp1523), N-His-tagged | +Inquiry |
| ABCC3-198M | Recombinant Mouse ABCC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCC3-405R | Recombinant Rat ABCC3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABCC3-9150HCL | Recombinant Human ABCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC3 Products
Required fields are marked with *
My Review for All ABCC3 Products
Required fields are marked with *
