Recombinant Human HRH1 Protein (211-416 aa), His-tagged
Cat.No. : | HRH1-2134H |
Product Overview : | Recombinant Human HRH1 Protein (211-416 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211-416 aa |
Description : | In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.1 kDa |
AA Sequence : | AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | HRH1 histamine receptor H1 [ Homo sapiens ] |
Official Symbol | HRH1 |
Synonyms | HRH1; histamine receptor H1; histamine H1 receptor; H1R; HH1R; H1-R; hisH1; |
Gene ID | 3269 |
mRNA Refseq | NM_000861 |
Protein Refseq | NP_000852 |
MIM | 600167 |
UniProt ID | P35367 |
◆ Recombinant Proteins | ||
RFL4849BF | Recombinant Full Length Bovine Histamine H1 Receptor(Hrh1) Protein, His-Tagged | +Inquiry |
Hrh1-1042G | Recombinant Guinea Pig Histamine Receptor H 1 | +Inquiry |
RFL4498MF | Recombinant Full Length Mouse Histamine H1 Receptor(Hrh1) Protein, His-Tagged | +Inquiry |
Hrh1-4826M | Recombinant Mouse Hrh1 protein | +Inquiry |
HRH1-3832Z | Recombinant Zebrafish HRH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRH1-5392HCL | Recombinant Human HRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRH1 Products
Required fields are marked with *
My Review for All HRH1 Products
Required fields are marked with *