Recombinant Human HRH1 Protein (211-416 aa), His-tagged

Cat.No. : HRH1-2134H
Product Overview : Recombinant Human HRH1 Protein (211-416 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 211-416 aa
Description : In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.1 kDa
AA Sequence : AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name HRH1 histamine receptor H1 [ Homo sapiens ]
Official Symbol HRH1
Synonyms HRH1; histamine receptor H1; histamine H1 receptor; H1R; HH1R; H1-R; hisH1;
Gene ID 3269
mRNA Refseq NM_000861
Protein Refseq NP_000852
MIM 600167
UniProt ID P35367

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRH1 Products

Required fields are marked with *

My Review for All HRH1 Products

Required fields are marked with *

0
cart-icon