Recombinant Human HRH3 Protein, GST-tagged

Cat.No. : HRH3-5037H
Product Overview : Human HRH3 partial ORF ( NP_009163, 257 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and can regulate neurotransmitter release. This receptor can also increase voltage-dependent calcium current in smooth muscles and innervates the blood vessels and the heart in cardiovascular system. [provided by RefSeq
Molecular Mass : 37.07 kDa
AA Sequence : GCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HRH3 histamine receptor H3 [ Homo sapiens ]
Official Symbol HRH3
Synonyms HRH3; histamine receptor H3; histamine H3 receptor; GPCR97; H3R; G protein-coupled receptor 97; G-protein coupled receptor 97; HH3R;
Gene ID 11255
mRNA Refseq NM_007232
Protein Refseq NP_009163
MIM 604525
UniProt ID Q9Y5N1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRH3 Products

Required fields are marked with *

My Review for All HRH3 Products

Required fields are marked with *

0
cart-icon
0
compare icon