Recombinant Human HRH3 Protein, GST-tagged
Cat.No. : | HRH3-5037H |
Product Overview : | Human HRH3 partial ORF ( NP_009163, 257 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and can regulate neurotransmitter release. This receptor can also increase voltage-dependent calcium current in smooth muscles and innervates the blood vessels and the heart in cardiovascular system. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | GCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HRH3 histamine receptor H3 [ Homo sapiens ] |
Official Symbol | HRH3 |
Synonyms | HRH3; histamine receptor H3; histamine H3 receptor; GPCR97; H3R; G protein-coupled receptor 97; G-protein coupled receptor 97; HH3R; |
Gene ID | 11255 |
mRNA Refseq | NM_007232 |
Protein Refseq | NP_009163 |
MIM | 604525 |
UniProt ID | Q9Y5N1 |
◆ Recombinant Proteins | ||
HRH3-2048H | Recombinant Human HRH3 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RFL5053RF | Recombinant Full Length Rat Histamine H3 Receptor(Hrh3) Protein, His-Tagged | +Inquiry |
HRH3-702H | Recombinant Human HRH3 | +Inquiry |
HRH3-3136Z | Recombinant Zebrafish HRH3 | +Inquiry |
RFL19166CF | Recombinant Full Length Guinea Pig Histamine H3 Receptor(Hrh3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRH3 Products
Required fields are marked with *
My Review for All HRH3 Products
Required fields are marked with *