Recombinant Human HS2ST1 Protein, GST-tagged
Cat.No. : | HS2ST1-5047H |
Product Overview : | Human HS2ST1 full-length ORF ( AAH25990.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq |
Molecular Mass : | 53.2 kDa |
AA Sequence : | MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HS2ST1 heparan sulfate 2-O-sulfotransferase 1 [ Homo sapiens ] |
Official Symbol | HS2ST1 |
Synonyms | HS2ST1; heparan sulfate 2-O-sulfotransferase 1; KIAA0448; 2OST; 2-O-sulfotransferase; dJ604K5.2; FLJ11317; MGC131986; |
Gene ID | 9653 |
mRNA Refseq | NM_001134492 |
Protein Refseq | NP_001127964 |
MIM | 604844 |
UniProt ID | Q7LGA3 |
◆ Recombinant Proteins | ||
HS2ST1-4322M | Recombinant Mouse HS2ST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HS2ST1-2145R | Recombinant Rhesus monkey HS2ST1 Protein, His-tagged | +Inquiry |
HS2ST1-105H | Active Recombinant Human HS2ST1, His-tagged | +Inquiry |
HS2ST1-1591H | Recombinant Human HS2ST1 protein, His & T7-tagged | +Inquiry |
RFL22355XF | Recombinant Full Length Xenopus Laevis Heparan Sulfate 2-O-Sulfotransferase 1(Hs2St1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS2ST1-5388HCL | Recombinant Human HS2ST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HS2ST1 Products
Required fields are marked with *
My Review for All HS2ST1 Products
Required fields are marked with *