Recombinant Human HS3ST2 Protein, GST-tagged

• Cat.No.: HS3ST2-5051H
• Product Overview: Human HS3ST2 partial ORF ( NP_006034, 268 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. This gene is expressed predominantly in brain and may play a role in the nervous system. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HS3ST2 heparan sulfate (glucosamine) 3-O-sulfotransferase 2 [ Homo sapiens ]
• Official Symbol: HS3ST2
• Synonyms: HS3ST2; heparan sulfate (glucosamine) 3-O-sulfotransferase 2; heparan sulfate glucosamine 3-O-sulfotransferase 2; 3OST2; 3-OST-2; h3-OST-2; heparan sulfate 3-O-sulfotransferase 2; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2; 30ST2
• Gene ID: 9956
• mRNA Refseq: NM_006043
• Protein Refseq: NP_006034
• MIM: 604056
• UniProt ID: Q9Y278