Recombinant Human HS3ST2 Protein, GST-tagged

Cat.No. : HS3ST2-5051H
Product Overview : Human HS3ST2 partial ORF ( NP_006034, 268 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. This gene is expressed predominantly in brain and may play a role in the nervous system. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETVGQDFRWE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HS3ST2 heparan sulfate (glucosamine) 3-O-sulfotransferase 2 [ Homo sapiens ]
Official Symbol HS3ST2
Synonyms HS3ST2; heparan sulfate (glucosamine) 3-O-sulfotransferase 2; heparan sulfate glucosamine 3-O-sulfotransferase 2; 3OST2; 3-OST-2; h3-OST-2; heparan sulfate 3-O-sulfotransferase 2; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2; 30ST2;
Gene ID 9956
mRNA Refseq NM_006043
Protein Refseq NP_006034
MIM 604056
UniProt ID Q9Y278

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HS3ST2 Products

Required fields are marked with *

My Review for All HS3ST2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon