Recombinant Human HSD11B1
Cat.No. : | HSD11B1-27736TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-292 of Human HSD11B1, with an N-terminal proprietary tag, predicted MWt 57.86 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 292 amino acids |
Description : | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein. |
Molecular Weight : | 57.860kDa inclusive of tags |
Tissue specificity : | Widely expressed. Highest expression in liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVT GASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE LGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ SNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | HSD11B1 |
Synonyms | HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; |
Gene ID | 3290 |
mRNA Refseq | NM_001206741 |
Protein Refseq | NP_001193670 |
MIM | 600713 |
Uniprot ID | P28845 |
Chromosome Location | 1q32-q41 |
Pathway | Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone => |
Function | 11-beta-hydroxysteroid dehydrogenase (NADP+) activity; 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
HSD11B1-1099H | Recombinant Human HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD11B1-2151R | Recombinant Rhesus monkey HSD11B1 Protein, His-tagged | +Inquiry |
HSD11B1-7869M | Recombinant Mouse HSD11B1 Protein | +Inquiry |
HSD11B1-2575R | Recombinant Rat HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD11B1-0319H | Recombinant Human HSD11B1 Protein (M1-K292), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
0
Inquiry Basket