Recombinant Human HSD11B1

Cat.No. : HSD11B1-27736TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-292 of Human HSD11B1, with an N-terminal proprietary tag, predicted MWt 57.86 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 292 amino acids
Description : The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein.
Molecular Weight : 57.860kDa inclusive of tags
Tissue specificity : Widely expressed. Highest expression in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVT GASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE LGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ SNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol HSD11B1
Synonyms HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1;
Gene ID 3290
mRNA Refseq NM_001206741
Protein Refseq NP_001193670
MIM 600713
Uniprot ID P28845
Chromosome Location 1q32-q41
Pathway Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone, organism-specific biosystem; C21-Steroid hormone biosynthesis, progesterone =>
Function 11-beta-hydroxysteroid dehydrogenase (NADP+) activity; 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity; nucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD11B1 Products

Required fields are marked with *

My Review for All HSD11B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon