Recombinant Human HSD17B1 protein, His-tagged
| Cat.No. : | HSD17B1-3290H |
| Product Overview : | Recombinant Human HSD17B1 protein(191 - 328 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 191 - 328 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELGDPPAAPQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ] |
| Official Symbol | HSD17B1 |
| Synonyms | HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1; E2DH; 20-alpha-HSD; 17-beta-HSD 1; estradiol 17-beta-dehydrogenase-1; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 1; placental 17-beta-hydroxysteroid dehydrogenase; hydroxysteroid (17-beta) dehydrogenase 1 isoform; short chain dehydrogenase/reductase family 28CE, member 1; EDHB17; EDH17B2; |
| Gene ID | 3292 |
| mRNA Refseq | NM_000413 |
| Protein Refseq | NP_000404 |
| MIM | 109684 |
| UniProt ID | P14061 |
| ◆ Recombinant Proteins | ||
| HSD17b1-3256R | Recombinant Rat HSD17b1 protein, His-SUMO-tagged | +Inquiry |
| HSD17B1-2152R | Recombinant Rhesus monkey HSD17B1 Protein, His-tagged | +Inquiry |
| HSD17B1-11624Z | Recombinant Zebrafish HSD17B1 | +Inquiry |
| HSD17B1-3804HF | Recombinant Full Length Human HSD17B1 Protein, GST-tagged | +Inquiry |
| HSD17B1-4356H | Recombinant Human HSD17B1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B1 Products
Required fields are marked with *
My Review for All HSD17B1 Products
Required fields are marked with *
