Recombinant Human HSD17B1 protein, His-tagged

Cat.No. : HSD17B1-3290H
Product Overview : Recombinant Human HSD17B1 protein(191 - 328 aa), fused to His tag, was expressed in E. coli.
Availability January 12, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191 - 328 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELGDPPAAPQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol HSD17B1
Synonyms HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1; E2DH; 20-alpha-HSD; 17-beta-HSD 1; estradiol 17-beta-dehydrogenase-1; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 1; placental 17-beta-hydroxysteroid dehydrogenase; hydroxysteroid (17-beta) dehydrogenase 1 isoform; short chain dehydrogenase/reductase family 28CE, member 1; EDHB17; EDH17B2;
Gene ID 3292
mRNA Refseq NM_000413
Protein Refseq NP_000404
MIM 109684
UniProt ID P14061

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B1 Products

Required fields are marked with *

My Review for All HSD17B1 Products

Required fields are marked with *

0
cart-icon
0
compare icon