Recombinant Human HSD17B10

Cat.No. : HSD17B10-28686TH
Product Overview : Recombinant full length Human ERAB expressed in Saccharomyces cerevisiae, 261 amino acids, MWt 26.9 KDa. Protein is tagged with a 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimers disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
Tissue specificity : Expressed in normal tissues but is overexpressed in neurons affected in AD.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLL DLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALA KGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASV AAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVM TIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Full Length : Full L.
Gene Name HSD17B10 hydroxysteroid (17-beta) dehydrogenase 10 [ Homo sapiens ]
Official Symbol HSD17B10
Synonyms HSD17B10; hydroxysteroid (17-beta) dehydrogenase 10; HADH2, hydroxyacyl Coenzyme A dehydrogenase, type II, hydroxyacyl Coenzyme A dehydrogenase, type II , mental retardation, X linked, syndromic 10 , MRXS10; 3-hydroxyacyl-CoA dehydrogenase type-2; 17b H
Gene ID 3028
mRNA Refseq NM_001037811
Protein Refseq NP_001032900
MIM 300256
Uniprot ID Q99714
Chromosome Location Xp11.2
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Branched-chain amino acid catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; 3-hydroxyacyl-CoA dehydrogenase activity; NAD binding; acetoacetyl-CoA reductase activity; beta-amyloid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B10 Products

Required fields are marked with *

My Review for All HSD17B10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon