Recombinant Human HSD17B10

• Cat.No.: HSD17B10-28686TH
• Product Overview: Recombinant full length Human ERAB expressed in Saccharomyces cerevisiae, 261 amino acids, MWt 26.9 KDa. Protein is tagged with a 26 kDa proprietary tag.

Specification

• Species: Human
• Tag: Non
• Description: This gene encodes 3-hydroxyacyl-CoA dehydrogenase type II, a member of the short-chain dehydrogenase/reductase superfamily. The gene product is a mitochondrial protein that catalyzes the oxidation of a wide variety of fatty acids, alcohols, and steroids. The protein has been implicated in the development of Alzheimers disease, and mutations in the gene are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Tissue specificity: Expressed in normal tissues but is overexpressed in neurons affected in AD.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLL DLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALA KGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASV AAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVM TIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
• Full Length: Full L.

Gene Information

• Gene Name: HSD17B10 hydroxysteroid (17-beta) dehydrogenase 10 [ Homo sapiens ]
• Official Symbol: HSD17B10
• Synonyms: HSD17B10; hydroxysteroid (17-beta) dehydrogenase 10; HADH2, hydroxyacyl Coenzyme A dehydrogenase, type II, hydroxyacyl Coenzyme A dehydrogenase, type II , mental retardation, X linked, syndromic 10 , MRXS10; 3-hydroxyacyl-CoA dehydrogenase type-2; 17b H
• Gene ID: 3028
• mRNA Refseq: NM_001037811
• Protein Refseq: NP_001032900
• MIM: 300256
• Uniprot ID: Q99714
• Chromosome Location: Xp11.2
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Branched-chain amino acid catabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; 3-hydroxyacyl-CoA dehydrogenase activity; NAD binding; acetoacetyl-CoA reductase activity; beta-amyloid binding