Recombinant Human HSD17B12, GST-tagged

• Cat.No.: HSD17B12-47H
• Product Overview: Recombinant Human HSD17B12(203 a.a. - 271 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation.
• Molecular Mass: 33.33 kDa
• AA Sequence: SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [Homo sapiens]
• Official Symbol: HSD17B12
• Synonyms: HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; 17beta-HSD type 12; KAR; estradiol 17-beta-dehydrogenase 12; SDR12C1; short chain dehydrogenase/reductase family 12C, member 1; 17-beta-HSD 12; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; EC 1.1.1.62; 3-ketoacyl-CoA reductase; EC 1.3.1.-; OTTHUMP00000232808
• Gene ID: 51144
• mRNA Refseq: NM_016142
• Protein Refseq: NP_057226
• MIM: 609574
• UniProt ID: Q53GQ0
• Chromosome Location: 11p11.2
• Pathway: Androgen biosynthesis; Fatty acid biosynthesis; Metabolism
• Function: collagen binding; estradiol 17-beta-dehydrogenase activity; fibronectin binding; heparin binding; protein binding