Recombinant Human HSD17B12, GST-tagged
Cat.No. : | HSD17B12-47H |
Product Overview : | Recombinant Human HSD17B12(203 a.a. - 271 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation. |
Molecular Mass : | 33.33 kDa |
AA Sequence : | SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSD17B12 hydroxysteroid (17-beta) dehydrogenase 12 [Homo sapiens] |
Official Symbol | HSD17B12 |
Synonyms | HSD17B12; hydroxysteroid (17-beta) dehydrogenase 12; 17beta-HSD type 12; KAR; estradiol 17-beta-dehydrogenase 12; SDR12C1; short chain dehydrogenase/reductase family 12C, member 1; 17-beta-HSD 12; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; EC 1.1.1.62; 3-ketoacyl-CoA reductase; EC 1.3.1.-; OTTHUMP00000232808 |
Gene ID | 51144 |
mRNA Refseq | NM_016142 |
Protein Refseq | NP_057226 |
MIM | 609574 |
UniProt ID | Q53GQ0 |
Chromosome Location | 11p11.2 |
Pathway | Androgen biosynthesis; Fatty acid biosynthesis; Metabolism |
Function | collagen binding; estradiol 17-beta-dehydrogenase activity; fibronectin binding; heparin binding; protein binding |
◆ Recombinant Proteins | ||
RFL20946BF | Recombinant Full Length Bovine Estradiol 17-Beta-Dehydrogenase 12(Hsd17B12) Protein, His-Tagged | +Inquiry |
HSD17B12-4333M | Recombinant Mouse HSD17B12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hsd17b12-1410M | Recombinant Mouse Hsd17b12 protein, His & GST-tagged | +Inquiry |
HSD17B12-345C | Recombinant Cynomolgus Monkey HSD17B12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hsd17b12-1411R | Recombinant Rat Hsd17b12 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B12-818HCL | Recombinant Human HSD17B12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B12 Products
Required fields are marked with *
My Review for All HSD17B12 Products
Required fields are marked with *