Recombinant Human HSP90AA1 protein, His-tagged
Cat.No. : | HSP90AA1-02H |
Product Overview : | Recombinant partial human HSP90AA1 was expressed in E. coli using an N-terminal 6xHis-tagged. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 233-291aa |
Description : | The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid or Lyophilized powder |
Molecular Mass : | 11.2 kDa |
AA Sequence : | DEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Expiry : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Storage Buffer : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 centigrade/-80 centigrade. Our default final concentration of glycerol is 50%. |
Gene Name | HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Homo sapiens (human) ] |
Official Symbol | HSP90AA1 |
Synonyms | Heat shock 86 kDa; Heat shock protein 90kDa alpha cytosolic class A member 1; Heat shock protein 90kDa alpha cytosolic class B member 1; Heat shock protein HSP 90 alpha; Heat shock protein HSP 90 beta; Heat shock protein HSP 90-alpha; HS90A_HUMAN; HSP 84; HSP 86; Hsp 90; HSP86; HSP90A; HSP90AA1; HSP90AB1; HSP90B; HSPC1; HSPC2; HSPCAL1; HSPCAL4; Renal carcinoma antigen NY-REN-38. |
Gene ID | 3320 |
mRNA Refseq | NM_001017963 |
Protein Refseq | NP_001017963 |
MIM | 140571 |
UniProt ID | P07900 |
◆ Recombinant Proteins | ||
HSP90AA1-3055H | Recombinant Human HSP90AA1 protein, His-SUMO-tagged | +Inquiry |
EI-1035 | Radicicol | +Inquiry |
HSP90AA1-2939R | Recombinant Rat HSP90AA1 Protein | +Inquiry |
HSP90AA1-1343H | Recombinant Human HSP90AA1 protein, His-tagged | +Inquiry |
HSP90aA1-2695 | Recombinant HSP90aA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90AA1-5362HCL | Recombinant Human HSP90AA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSP90AA1 Products
Required fields are marked with *
My Review for All HSP90AA1 Products
Required fields are marked with *
0
Inquiry Basket