Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
233-291aa |
Description : |
The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. |
Form : |
Liquid or Lyophilized powder |
Molecular Mass : |
11.2 kDa |
AA Sequence : |
DEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELN |
Purity : |
Greater than 85% as determined by SDS-PAGE. |
Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : |
Store at -20 centigrade/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Expiry : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Storage Buffer : |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 centigrade/-80 centigrade. Our default final concentration of glycerol is 50%. |