Recombinant Human HSPB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HSPB1-5358H |
Product Overview : | HSPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001531) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. |
Molecular Mass : | 22.8 kDa |
AA Sequence : | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HSPB1 heat shock 27kDa protein 1 [ Homo sapiens (human) ] |
Official Symbol | HSPB1 |
Synonyms | HSPB1; heat shock 27kDa protein 1; heat shock 27kD protein 1; heat shock protein beta-1; Hs.76067; Hsp25; HSP27; HSP28; HSP 27; 28 kDa heat shock protein; heat shock 27 kDa protein; stress-responsive protein 27; estrogen-regulated 24 kDa protein; CMT2F; HMN2B; SRP27; HS.76067; DKFZp586P1322; |
Gene ID | 3315 |
mRNA Refseq | NM_001540 |
Protein Refseq | NP_001531 |
MIM | 602195 |
UniProt ID | P04792 |
◆ Recombinant Proteins | ||
HSPB1-2950R | Recombinant Rat HSPB1 Protein | +Inquiry |
HSPB1-13990H | Recombinant Human HSPB1, GST-tagged | +Inquiry |
HSPB1-849H | Recombinant Human HSPB1 protein, MYC/DDK-tagged | +Inquiry |
HSPB1-27737TH | Recombinant Human HSPB1 | +Inquiry |
HSPB1-1905Z | Recombinant Zebrafish HSPB1 | +Inquiry |
◆ Native Proteins | ||
HSPB1-1553H | Recombinant Human HSPB1 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB1-5351HCL | Recombinant Human HSPB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSPB1 Products
Required fields are marked with *
My Review for All HSPB1 Products
Required fields are marked with *
0
Inquiry Basket