Recombinant Human HSPB11 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HSPB11-3443H |
Product Overview : | HSPB11 MS Standard C13 and N15-labeled recombinant protein (NP_057210) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the IFT complex B required for sonic hedgehog/SHH signaling. May mediate transport of SHH components: required for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to activation of the SHH pathway, suggesting it is involved in the dynamic transport of SHH signaling molecules within the cilium. Not required for ciliary assembly. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation (By similarity). |
Molecular Mass : | 16.3 kDa |
AA Sequence : | MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HSPB11 heat shock protein family B (small) member 11 [ Homo sapiens (human) ] |
Official Symbol | HSPB11 |
Synonyms | HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25; placental protein 25; intraflagellar transport 25 homolog; C1orf41; |
Gene ID | 51668 |
mRNA Refseq | NM_016126 |
Protein Refseq | NP_057210 |
UniProt ID | Q9Y547 |
◆ Recombinant Proteins | ||
HSPB11-3443H | Recombinant Human HSPB11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPB11-27165TH | Recombinant Human HSPB11 | +Inquiry |
HSPB11-3965HF | Recombinant Full Length Human HSPB11 Protein, GST-tagged | +Inquiry |
HSPB11-2168R | Recombinant Rhesus monkey HSPB11 Protein, His-tagged | +Inquiry |
HSPB11-3520H | Recombinant Human HSPB11, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB11-5350HCL | Recombinant Human HSPB11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB11 Products
Required fields are marked with *
My Review for All HSPB11 Products
Required fields are marked with *