Recombinant Human HSPB11, His-tagged

Cat.No. : HSPB11-27166TH
Product Overview : Recombinant full length Human C1orf41 with an N terminal His tag; 164 amino acids, predicted MWt 18.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 144 amino acids
Description : HSPCO34 protein, chromosome 1 open reading frame 41.
Conjugation : HIS
Molecular Weight : 18.500kDa inclusive of tags
Tissue specificity : Detected in placenta.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Gene Name HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ]
Official Symbol HSPB11
Synonyms HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25;
Gene ID 51668
mRNA Refseq NM_016126
Protein Refseq NP_057210
Uniprot ID Q9Y547
Chromosome Location 1p32

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB11 Products

Required fields are marked with *

My Review for All HSPB11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon