Recombinant Human HSPB6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HSPB6-4694H |
Product Overview : | HSPB6 MS Standard C13 and N15-labeled recombinant protein (NP_653218) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MEIPVPVQPSWLRRASAPLLGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HSPB6 heat shock protein family B (small) member 6 [ Homo sapiens (human) ] |
Official Symbol | HSPB6 |
Synonyms | HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20; |
Gene ID | 126393 |
mRNA Refseq | NM_144617 |
Protein Refseq | NP_653218 |
MIM | 610695 |
UniProt ID | O14558 |
◆ Recombinant Proteins | ||
HSPB6-28486TH | Recombinant Human HSPB6 | +Inquiry |
HSPB6-2608R | Recombinant Rat HSPB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPB6-1253H | Recombinant Human Heat Shock Protein, Alpha-crystallin-related, B6 | +Inquiry |
HSPB6-044H | Recombinant Human HSPB6 Protein | +Inquiry |
Hspb6-1450R | Recombinant Rat Hspb6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB6-5347HCL | Recombinant Human HSPB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB6 Products
Required fields are marked with *
My Review for All HSPB6 Products
Required fields are marked with *