Recombinant Human HSPB6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HSPB6-4694H
• Product Overview: HSPB6 MS Standard C13 and N15-labeled recombinant protein (NP_653218) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.
• Molecular Mass: 17.2 kDa
• AA Sequence: MEIPVPVQPSWLRRASAPLLGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HSPB6 heat shock protein family B (small) member 6 [ Homo sapiens (human) ]
• Official Symbol: HSPB6
• Synonyms: HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20
• Gene ID: 126393
• mRNA Refseq: NM_144617
• Protein Refseq: NP_653218
• MIM: 610695
• UniProt ID: O14558