Recombinant Human HSPB7, His-tagged
Cat.No. : | HSPB7-26656TH |
Product Overview : | Recombinant full length Human cvHSP with an N-terminal His tag; predicted MWt 20.7 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 170 amino acids |
Description : | HSPB7 is a member of HSPB (Heat shock protein beta) family. The HSPB family is one of the more diverse families within the group of HSP families. Some members have chaperone-like activities and/or play a role in cytoskeletal stabilization. |
Conjugation : | HIS |
Molecular Weight : | 20.700kDa inclusive of tags |
Tissue specificity : | Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSS SSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA LREDGSLTIRARRHPHTEHVQQTFRTEIKI |
Sequence Similarities : | Belongs to the small heat shock protein (HSP20) family. |
Gene Name | HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ] |
Official Symbol | HSPB7 |
Synonyms | HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP; |
Gene ID | 27129 |
mRNA Refseq | NM_014424 |
Protein Refseq | NP_055239 |
MIM | 610692 |
Uniprot ID | Q9UBY9 |
Chromosome Location | 1p36.23-p34.3 |
Function | protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
HSPB7-1554Z | Recombinant Zebrafish HSPB7 | +Inquiry |
HSPB7-3509H | Recombinant Human HSPB7 Protein (Met1-Ile170), N-His tagged | +Inquiry |
HSPB7-124H | Recombinant Human HSPB7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSPB7-172H | Recombinant Human HSPB7 protein, T7-tagged | +Inquiry |
HSPB7-4365M | Recombinant Mouse HSPB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPB7-5346HCL | Recombinant Human HSPB7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPB7 Products
Required fields are marked with *
My Review for All HSPB7 Products
Required fields are marked with *
0
Inquiry Basket