Recombinant Human HSPG2 Protein, GST-tagged

Cat.No. : HSPG2-5262H
Product Overview : Human HSPG2 partial ORF ( NP_005520.3, 25 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM
Molecular Mass : 37.84 kDa
AA Sequence : GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPG2 heparan sulfate proteoglycan 2 [ Homo sapiens ]
Official Symbol HSPG2
Synonyms HSPG2; heparan sulfate proteoglycan 2; Schwartz Jampel syndrome 1 (chondrodystrophic myotonia) , SJS1; basement membrane-specific heparan sulfate proteoglycan core protein; perlecan; perlecan proteoglycan; PRCAN; endorepellin (domain V region); PLC; SJA; SJS; HSPG; SJS1;
Gene ID 3339
mRNA Refseq NM_005529
Protein Refseq NP_005520
MIM 142461
UniProt ID P98160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPG2 Products

Required fields are marked with *

My Review for All HSPG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon