Recombinant Human HSPG2 Protein, GST-tagged
Cat.No. : | HSPG2-5262H |
Product Overview : | Human HSPG2 partial ORF ( NP_005520.3, 25 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM |
Molecular Mass : | 37.84 kDa |
AA Sequence : | GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSPG2 heparan sulfate proteoglycan 2 [ Homo sapiens ] |
Official Symbol | HSPG2 |
Synonyms | HSPG2; heparan sulfate proteoglycan 2; Schwartz Jampel syndrome 1 (chondrodystrophic myotonia) , SJS1; basement membrane-specific heparan sulfate proteoglycan core protein; perlecan; perlecan proteoglycan; PRCAN; endorepellin (domain V region); PLC; SJA; SJS; HSPG; SJS1; |
Gene ID | 3339 |
mRNA Refseq | NM_005529 |
Protein Refseq | NP_005520 |
MIM | 142461 |
UniProt ID | P98160 |
◆ Recombinant Proteins | ||
HSPG2-5026H | Recombinant Human HSPG2 protein, His&Myc-tagged | +Inquiry |
HSPG2-1178C | Recombinant Chicken HSPG2 | +Inquiry |
HSPG2-8046H | Recombinant Human HSPG2 protein, His-tagged | +Inquiry |
HSPG2-01H | Active Recombinant Human HSPG2 protein, His-tagged | +Inquiry |
HSPG2-29309TH | Recombinant Human HSPG2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPG2 Products
Required fields are marked with *
My Review for All HSPG2 Products
Required fields are marked with *