Recombinant Human HTATIP2, His-tagged
Cat.No. : | HTATIP2-30679TH |
Product Overview : | Recombinant full length Human TIP30 protein with an N terminal His tag; 262 amino acids ; predicted mwt: 29.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 242 amino acids |
Description : | Oxidoreductase HTATIP2 is an enzyme that in humans is encoded by the HTATIP2 gene. It may be a metastasis suppressor. |
Conjugation : | HIS |
Molecular Weight : | 29.300kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP |
Gene Name | HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ] |
Official Symbol | HTATIP2 |
Synonyms | HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; |
Gene ID | 10553 |
mRNA Refseq | NM_001098523 |
Protein Refseq | NP_001091993 |
MIM | 605628 |
Uniprot ID | Q9BUP3 |
Chromosome Location | 11p15.1 |
Function | NAD binding; oxidoreductase activity; oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor; protein binding; transcription coactivator activity; |
◆ Recombinant Proteins | ||
HTATIP2-30679TH | Recombinant Human HTATIP2, His-tagged | +Inquiry |
HTATIP2-7927M | Recombinant Mouse HTATIP2 Protein | +Inquiry |
HTATIP2-2723H | Recombinant Human HIV-1 Tat Interactive Protein 2, 30kDa, His-tagged | +Inquiry |
HTATIP2-5256H | Recombinant Human HTATIP2 Protein, GST-tagged | +Inquiry |
HTATIP2-2193H | Recombinant Human HTATIP2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTATIP2-826HCL | Recombinant Human HTATIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTATIP2 Products
Required fields are marked with *
My Review for All HTATIP2 Products
Required fields are marked with *