"HTN1" Related Products

Recombinant Human HTN1 Protein, GST-tagged

Cat.No.: HTN1-5253H
Product Overview: Human HTN1 full-length ORF (AAH17835.1, 1 a.a. - 57 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Aug 2014]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 33.4 kDa
AA Sequence: MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: HTN1 histatin 1 [ Homo sapiens ]
Official Symbol: HTN1
Synonyms: HTN1; histatin 1; histatin-1; HIS1; PPB; post-PB protein; histidine-rich protein 1;
Gene ID: 3346
mRNA Refseq: NM_002159
Protein Refseq: NP_002150
MIM: 142701
UniProt ID: P15515

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.