Recombinant Human HTN1 Protein, GST-tagged
Cat.No. : | HTN1-5253H |
Product Overview : | Human HTN1 full-length ORF (AAH17835.1, 1 a.a. - 57 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Aug 2014] |
Molecular Mass : | 33.4 kDa |
AA Sequence : | MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTN1 histatin 1 [ Homo sapiens ] |
Official Symbol | HTN1 |
Synonyms | HTN1; histatin 1; histatin-1; HIS1; PPB; post-PB protein; histidine-rich protein 1; |
Gene ID | 3346 |
mRNA Refseq | NM_002159 |
Protein Refseq | NP_002150 |
MIM | 142701 |
UniProt ID | P15515 |
◆ Recombinant Proteins | ||
HTN1-251H | Recombinant Human HTN1 Protein, His-tagged | +Inquiry |
HTN1-5253H | Recombinant Human HTN1 Protein, GST-tagged | +Inquiry |
HTN1-5670HF | Recombinant Full Length Human HTN1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTN1-827HCL | Recombinant Human HTN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTN1 Products
Required fields are marked with *
My Review for All HTN1 Products
Required fields are marked with *