Recombinant Human HTR2A protein, His-tagged
| Cat.No. : | HTR2A-4899H |
| Product Overview : | Recombinant Human HTR2A protein(387-471 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 387-471 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | YRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HTR2A 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR2A |
| Synonyms | HTR2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 2A , HTR2; 5-hydroxytryptamine receptor 2A; 5 HT2A; 5-HT-2A; 5-HT2 receptor; serotonin 5-HT-2A receptor; HTR2; 5-HT2A; |
| Gene ID | 3356 |
| mRNA Refseq | NM_000621 |
| Protein Refseq | NP_000612 |
| MIM | 182135 |
| UniProt ID | P28223 |
| ◆ Recombinant Proteins | ||
| HTR2A-1996R | Recombinant Rhesus Macaque HTR2A Protein, His (Fc)-Avi-tagged | +Inquiry |
| HTR2A-4899H | Recombinant Human HTR2A protein, His-tagged | +Inquiry |
| HTR2A-1561H | Recombinant Human HTR2A, His-tagged | +Inquiry |
| RFL20834MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) 5-Hydroxytryptamine Receptor 2A(Htr2A) Protein, His-Tagged | +Inquiry |
| HTR2A-2175R | Recombinant Rhesus monkey HTR2A Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR2A Products
Required fields are marked with *
My Review for All HTR2A Products
Required fields are marked with *
