Recombinant Human HTR2C

Cat.No. : HTR2C-26028TH
Product Overview : Recombinant fragment of Human 5HT2C Receptor with N terminal proprietary tag, 31.35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 52 amino acids
Description : Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims.
Molecular Weight : 31.350kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name HTR2C 5-hydroxytryptamine (serotonin) receptor 2C [ Homo sapiens ]
Official Symbol HTR2C
Synonyms HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C; HTR1C; 5-hydroxytryptamine receptor 2C; 5 HT2C;
Gene ID 3358
mRNA Refseq NM_000868
Protein Refseq NP_000859
MIM 312861
Uniprot ID P28335
Chromosome Location Xq23
Pathway Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding; G-protein coupled receptor activity; drug binding; phosphatidylinositol phospholipase C activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR2C Products

Required fields are marked with *

My Review for All HTR2C Products

Required fields are marked with *

0
cart-icon