Recombinant Human HTR2C Protein, GST-tagged
Cat.No. : | HTR2C-5241H |
Product Overview : | Human HTR2C partial ORF ( NP_000859, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims. [provided by RefSeq |
Molecular Mass : | 31.46 kDa |
AA Sequence : | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR2C |
Synonyms | HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 2C , HTR1C; 5-hydroxytryptamine receptor 2C; 5 HT2C; 5-HT1C; 5-HT-1C; 5-HT-2C; serotonin receptor 2C; serotonin 5-HT-2C receptor; 5-hydroxytryptamine receptor 1C; HTR1C; 5-HT2C; 5-HTR2C; |
Gene ID | 3358 |
mRNA Refseq | NM_000868 |
Protein Refseq | NP_000859 |
MIM | 312861 |
UniProt ID | P28335 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR2C Products
Required fields are marked with *
My Review for All HTR2C Products
Required fields are marked with *