Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged
Cat.No. : | HUWE1-4016H |
Product Overview : | Recombinant Human HUWE1 protein(Q7Z6Z7)(4005-4374aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 4005-4374aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA |
Gene Name | HUWE1 HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | HUWE1 |
Synonyms | HUWE1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain containing 1; E3 ubiquitin-protein ligase HUWE1; Ib772; KIAA0312; UREB1; ARF-binding protein 1; URE-binding protein 1; BJ-HCC-24 tumor antigen; large structure of UREB1; HECT domain protein LASU1; Mcl-1 ubiquitin ligase E3; upstream regulatory element-binding protein 1; homologous to E6AP carboxyl terminus homologous protein 9; MULE; LASU1; HECTH9; URE-B1; ARF-BP1; HSPC272; |
Gene ID | 10075 |
mRNA Refseq | NM_031407 |
Protein Refseq | NP_113584 |
MIM | 300697 |
UniProt ID | Q7Z6Z7 |
◆ Recombinant Proteins | ||
HUWE1-4016H | Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged | +Inquiry |
HUWE1-2000R | Recombinant Rhesus Macaque HUWE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HUWE1-2179R | Recombinant Rhesus monkey HUWE1 Protein, His-tagged | +Inquiry |
HUWE1-136H | Recombinant Human HUWE1, GST-tagged | +Inquiry |
HUWE1-7877H | Recombinant Human HUWE1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HUWE1 Products
Required fields are marked with *
My Review for All HUWE1 Products
Required fields are marked with *