Recombinant Human HUWE1, GST-tagged

Cat.No. : HUWE1-14015H
Product Overview : Recombinant Human HUWE1(4281 a.a. - 4374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein containing a C-terminal HECT (E6AP type E3 ubiquitin protein ligase) domain that functions as an E3 ubiquitin ligase. The encoded protein is required for the ubiquitination and subsequent degradation of the anti-apoptotic protein Mcl1 (myeloid cell leukemia sequence 1 (BCL2-related)). This protein also ubiquitinates the p53 tumor suppressor, core histones, and DNA polymerase beta. Mutations in this gene are associated with Turner type X-linked syndromic mental retardation.
Molecular Mass : 36.08 kDa
AA Sequence : FWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEK LRHMLLLAIQECSEGFGLA
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HUWE1 HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol HUWE1
Synonyms HUWE1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain containing 1; E3 ubiquitin-protein ligase HUWE1; Ib772; KIAA0312; UREB1; ARF-binding protein 1; URE-binding protein 1; BJ-HCC-24 tumor antigen; large structure of UREB1; HECT domain protein LASU1; Mcl-1 ubiquitin ligase E3; upstream regulatory element-binding protein 1; homologous to E6AP carboxyl terminus homologous protein 9; MULE; LASU1; HECTH9; URE-B1; ARF-BP1; HSPC272
Gene ID 10075
mRNA Refseq NM_031407
Protein Refseq NP_113584
MIM 300697
UniProt ID Q7Z6Z7
Chromosome Location Xp11.22
Pathway Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation
Function DNA binding; poly(A) RNA binding; protein binding; ubiquitin-protein ligase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HUWE1 Products

Required fields are marked with *

My Review for All HUWE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon