Recombinant Human HUWE1, GST-tagged
| Cat.No. : | HUWE1-14015H |
| Product Overview : | Recombinant Human HUWE1(4281 a.a. - 4374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein containing a C-terminal HECT (E6AP type E3 ubiquitin protein ligase) domain that functions as an E3 ubiquitin ligase. The encoded protein is required for the ubiquitination and subsequent degradation of the anti-apoptotic protein Mcl1 (myeloid cell leukemia sequence 1 (BCL2-related)). This protein also ubiquitinates the p53 tumor suppressor, core histones, and DNA polymerase beta. Mutations in this gene are associated with Turner type X-linked syndromic mental retardation. |
| Molecular Mass : | 36.08 kDa |
| AA Sequence : | FWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEK LRHMLLLAIQECSEGFGLA |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HUWE1 HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | HUWE1 |
| Synonyms | HUWE1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain containing 1; E3 ubiquitin-protein ligase HUWE1; Ib772; KIAA0312; UREB1; ARF-binding protein 1; URE-binding protein 1; BJ-HCC-24 tumor antigen; large structure of UREB1; HECT domain protein LASU1; Mcl-1 ubiquitin ligase E3; upstream regulatory element-binding protein 1; homologous to E6AP carboxyl terminus homologous protein 9; MULE; LASU1; HECTH9; URE-B1; ARF-BP1; HSPC272 |
| Gene ID | 10075 |
| mRNA Refseq | NM_031407 |
| Protein Refseq | NP_113584 |
| MIM | 300697 |
| UniProt ID | Q7Z6Z7 |
| Chromosome Location | Xp11.22 |
| Pathway | Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation |
| Function | DNA binding; poly(A) RNA binding; protein binding; ubiquitin-protein ligase activity |
| ◆ Recombinant Proteins | ||
| HUWE1-136H | Recombinant Human HUWE1, GST-tagged | +Inquiry |
| HUWE1-7876H | Recombinant Human HUWE1 protein, GST-tagged | +Inquiry |
| HUWE1-4016H | Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged | +Inquiry |
| HUWE1-2179R | Recombinant Rhesus monkey HUWE1 Protein, His-tagged | +Inquiry |
| HUWE1-7877H | Recombinant Human HUWE1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HUWE1 Products
Required fields are marked with *
My Review for All HUWE1 Products
Required fields are marked with *
