Recombinant Human HUWE1, GST-tagged
Cat.No. : | HUWE1-14015H |
Product Overview : | Recombinant Human HUWE1(4281 a.a. - 4374 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein containing a C-terminal HECT (E6AP type E3 ubiquitin protein ligase) domain that functions as an E3 ubiquitin ligase. The encoded protein is required for the ubiquitination and subsequent degradation of the anti-apoptotic protein Mcl1 (myeloid cell leukemia sequence 1 (BCL2-related)). This protein also ubiquitinates the p53 tumor suppressor, core histones, and DNA polymerase beta. Mutations in this gene are associated with Turner type X-linked syndromic mental retardation. |
Molecular Mass : | 36.08 kDa |
AA Sequence : | FWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEK LRHMLLLAIQECSEGFGLA |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HUWE1 HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | HUWE1 |
Synonyms | HUWE1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain containing 1; E3 ubiquitin-protein ligase HUWE1; Ib772; KIAA0312; UREB1; ARF-binding protein 1; URE-binding protein 1; BJ-HCC-24 tumor antigen; large structure of UREB1; HECT domain protein LASU1; Mcl-1 ubiquitin ligase E3; upstream regulatory element-binding protein 1; homologous to E6AP carboxyl terminus homologous protein 9; MULE; LASU1; HECTH9; URE-B1; ARF-BP1; HSPC272 |
Gene ID | 10075 |
mRNA Refseq | NM_031407 |
Protein Refseq | NP_113584 |
MIM | 300697 |
UniProt ID | Q7Z6Z7 |
Chromosome Location | Xp11.22 |
Pathway | Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation |
Function | DNA binding; poly(A) RNA binding; protein binding; ubiquitin-protein ligase activity |
◆ Recombinant Proteins | ||
HUWE1-7876H | Recombinant Human HUWE1 protein, GST-tagged | +Inquiry |
HUWE1-2000R | Recombinant Rhesus Macaque HUWE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HUWE1-136H | Recombinant Human HUWE1, GST-tagged | +Inquiry |
HUWE1-14015H | Recombinant Human HUWE1, GST-tagged | +Inquiry |
HUWE1-4016H | Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HUWE1 Products
Required fields are marked with *
My Review for All HUWE1 Products
Required fields are marked with *