Recombinant Human HVCN1 protein, His-tagged

Cat.No. : HVCN1-1410H
Product Overview : Recombinant Human HVCN1 protein(NP_001035196.1)(Met1~Val138) was fused to His Tag and expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1~Val138
Description : This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 13/14kDa(Analysis of differences refer to the manual)
AA Sequence : MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMV
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 80%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
(May be suitable for use in other assays to be determined by the end user.)
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Concentration : 200µg/mL
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name HVCN1
Official Symbol HVCN1
Synonyms Hv1, VSOP, Voltage Sensor Domain-Only Protein, Hydrogen voltage-gated channel 1
Gene ID 84329
mRNA Refseq NM_001040107.2
Protein Refseq NP_001035196.1
UniProt ID Q96D96

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HVCN1 Products

Required fields are marked with *

My Review for All HVCN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon