Recombinant Human HYOU1, His-tagged

Cat.No. : HYOU1-30518TH
Product Overview : Recombinant fragment, corresponding to amino acids 424-999 of Human ORP150 with N terminal His tag; Predicted MWt 65 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 424-999 a.a.
Description : The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5 UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal.
Conjugation : HIS
Tissue specificity : Highly expressed in tissues that contain well-developed endoplasmic reticulum and synthesize large amounts of secretory proteins. Highly expressed in liver and pancreas and lower expression in brain and kidney. Also expressed in macrophages within aortic
Form : Lyophilised:Reconstitute with 129 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLK HNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLG FLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGI KAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKL GNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEK ENGDKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKR RMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDL EKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQRE EISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQ IFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPV LLSKDIEAKMMALDREVQYLLNKAKFTKPRPRPKDKNG TRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVE TGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Sequence Similarities : Belongs to the heat shock protein 70 family.
Gene Name HYOU1 hypoxia up-regulated 1 [ Homo sapiens ]
Official Symbol HYOU1
Synonyms HYOU1; hypoxia up-regulated 1; hypoxia up-regulated protein 1; glucose regulated protein 170; Grp170; HSP12A; ORP150;
Gene ID 10525
mRNA Refseq NM_001130991
Protein Refseq NP_001124463
MIM 601746
Uniprot ID Q9Y4L1
Chromosome Location 11q23.1-q23.3
Pathway Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function ATP binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYOU1 Products

Required fields are marked with *

My Review for All HYOU1 Products

Required fields are marked with *

0
cart-icon
0
compare icon