Recombinant Human HYPM Protein

• Cat.No.: HYPM-2189H
• Product Overview: Human CXorf27 (NP_036406.1) full-length recombinant protein in yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: Non
• Description: This gene encodes a protein shown to interact with huntingtin, which contains an expanded polyglutamine tract in individuals with Huntington's disease (PMID: 9700202). [provided by RefSeq, Aug 2011]
• Form: Liquid
• Molecular Mass: 13 kDa
• AA Sequence: MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND
• Purity: 90%
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)

Gene Information

• Gene Name: HYPM huntingtin interacting protein M [ Homo sapiens (human) ]
• Official Symbol: HYPM
• Synonyms: HYPM; huntingtin interacting protein M; 1700054O13Rik; Chromosome X open reading frame 27; CXorf27; HIP17; Huntingtin interacting protein M; Huntingtin yeast partner M; Huntingtin-interacting protein M; HYPM; HYPM_HUMAN
• Gene ID: 25763
• mRNA Refseq: NM_012274.1
• Protein Refseq: NP_036406.1
• UniProt ID: O75409