Recombinant Human HYPM Protein

Cat.No. : HYPM-2189H
Product Overview : Human CXorf27 (NP_036406.1) full-length recombinant protein in yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : Non
Description : This gene encodes a protein shown to interact with huntingtin, which contains an expanded polyglutamine tract in individuals with Huntington's disease (PMID: 9700202). [provided by RefSeq, Aug 2011]
Form : Liquid
Molecular Mass : 13 kDa
AA Sequence : MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND
Purity : 90%
Applications : SDS-PAGE
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene Name HYPM huntingtin interacting protein M [ Homo sapiens (human) ]
Official Symbol HYPM
Synonyms HYPM; huntingtin interacting protein M; 1700054O13Rik; Chromosome X open reading frame 27; CXorf27; HIP17; Huntingtin interacting protein M; Huntingtin yeast partner M; Huntingtin-interacting protein M; HYPM; HYPM_HUMAN;
Gene ID 25763
mRNA Refseq NM_012274.1
Protein Refseq NP_036406.1
UniProt ID O75409

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYPM Products

Required fields are marked with *

My Review for All HYPM Products

Required fields are marked with *

0
cart-icon
0
compare icon