Recombinant Human HYPM Protein
Cat.No. : | HYPM-2189H |
Product Overview : | Human CXorf27 (NP_036406.1) full-length recombinant protein in yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Description : | This gene encodes a protein shown to interact with huntingtin, which contains an expanded polyglutamine tract in individuals with Huntington's disease (PMID: 9700202). [provided by RefSeq, Aug 2011] |
Form : | Liquid |
Molecular Mass : | 13 kDa |
AA Sequence : | MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND |
Purity : | 90% |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
Gene Name | HYPM huntingtin interacting protein M [ Homo sapiens (human) ] |
Official Symbol | HYPM |
Synonyms | HYPM; huntingtin interacting protein M; 1700054O13Rik; Chromosome X open reading frame 27; CXorf27; HIP17; Huntingtin interacting protein M; Huntingtin yeast partner M; Huntingtin-interacting protein M; HYPM; HYPM_HUMAN; |
Gene ID | 25763 |
mRNA Refseq | NM_012274.1 |
Protein Refseq | NP_036406.1 |
UniProt ID | O75409 |
◆ Recombinant Proteins | ||
HYPM-2189H | Recombinant Human HYPM Protein | +Inquiry |
HYPM-2275H | Recombinant Human HYPM Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYPM-208HCL | Recombinant Human HYPM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYPM Products
Required fields are marked with *
My Review for All HYPM Products
Required fields are marked with *
0
Inquiry Basket