Recombinant Human IAH1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IAH1-5068H |
Product Overview : | IAH1 MS Standard C13 and N15-labeled recombinant protein (NP_001034702) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | IAH1 (Isoamyl Acetate Hydrolyzing Esterase 1 (Putative)) is a Protein Coding gene. Diseases associated with IAH1 include Inflammatory Skin And Bowel Disease, Neonatal, 1 and 3-Methylglutaconic Aciduria, Type I. Gene Ontology (GO) annotations related to this gene include hydrolase activity and hydrolase activity, acting on ester bonds. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IAH1 isoamyl acetate hydrolyzing esterase 1 (putative) [ Homo sapiens (human) ] |
Official Symbol | IAH1 |
Synonyms | IAH1; isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae); isoamyl acetate-hydrolyzing esterase 1 homolog; MGC102860; |
Gene ID | 285148 |
mRNA Refseq | NM_001039613 |
Protein Refseq | NP_001034702 |
UniProt ID | Q2TAA2 |
◆ Recombinant Proteins | ||
IAH1-5100C | Recombinant Chicken IAH1 | +Inquiry |
IAH1-7421B | Recombinant Baker's yeast IAH1 protein, His&Myc-tagged | +Inquiry |
IAH1-4396M | Recombinant Mouse IAH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IAH1-5068H | Recombinant Human IAH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Iah1-3467M | Recombinant Mouse Iah1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IAH1-5320HCL | Recombinant Human IAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IAH1 Products
Required fields are marked with *
My Review for All IAH1 Products
Required fields are marked with *