Recombinant Human IBA1 protein, GST-tagged
Cat.No. : | IBA1-14028H |
Product Overview : | Recombinant Human IBA1 protein(1-147 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-147 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
Gene Name | AIF1 allograft inflammatory factor 1 [ Homo sapiens ] |
Official Symbol | AIF1 |
Synonyms | AIF1; allograft inflammatory factor 1; AIF 1; Em:AF129756.17; IBA1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; IRT 1; protein G1; ionized calcium-binding adapter molecule 1; allograft inflammatory factor-1 splice variant Hara-1; IRT1; AIF-1; IRT-1; IBA1 |
Gene ID | 199 |
mRNA Refseq | NM_001623 |
Protein Refseq | NP_001614 |
MIM | 601833 |
UniProt ID | P55008 |
◆ Recombinant Proteins | ||
IBA1-1128H | Recombinant Human IBA1 protein, GST-tagged | +Inquiry |
IBA1-14028H | Recombinant Human IBA1 protein, GST-tagged | +Inquiry |
IBA1-2839H | Recombinant Human IBA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IBA1 Products
Required fields are marked with *
My Review for All IBA1 Products
Required fields are marked with *