Recombinant Human ICA1 Protein (1-268 aa), His-tagged
Cat.No. : | ICA1-1418H |
Product Overview : | Recombinant Human ICA1 Protein (1-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-268 aa |
Description : | May play a role in neurotransmitter secretion. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.5 kDa |
AA Sequence : | MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ] |
Official Symbol | ICA1 |
Synonyms | ICA1; ICAp69; p69; ICA69; |
Gene ID | 3382 |
mRNA Refseq | NM_001136020 |
Protein Refseq | NP_001129492 |
MIM | 147625 |
UniProt ID | Q05084 |
◆ Recombinant Proteins | ||
ICA1-845HFL | Recombinant Full Length Human ICA1 Protein, C-Flag-tagged | +Inquiry |
Ica1-1203M | Recombinant Mouse Ica1 Protein, MYC/DDK-tagged | +Inquiry |
ICA1-1418H | Recombinant Human ICA1 Protein (1-268 aa), His-tagged | +Inquiry |
ICA1-2763H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
ICA1-5431H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICA1-5315HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
ICA1-5316HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICA1 Products
Required fields are marked with *
My Review for All ICA1 Products
Required fields are marked with *