Recombinant Human ICA1 Protein (1-268 aa), His-tagged

• Cat.No.: ICA1-1418H
• Product Overview: Recombinant Human ICA1 Protein (1-268 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-268 aa
• Description: May play a role in neurotransmitter secretion.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.5 kDa
• AA Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ]
• Official Symbol: ICA1
• Synonyms: ICA1; ICAp69; p69; ICA69
• Gene ID: 3382
• mRNA Refseq: NM_001136020
• Protein Refseq: NP_001129492
• MIM: 147625
• UniProt ID: Q05084