Recombinant Human ICA1 protein, His-tagged
| Cat.No. : | ICA1-3060H |
| Product Overview : | Recombinant Human ICA1 protein(Q05084)(1-268aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-268aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.5 kDa |
| AA Sequence : | MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ] |
| Official Symbol | ICA1 |
| Synonyms | ICA1; islet cell autoantigen 1, 69kDa; islet cell autoantigen 1 (69kD); islet cell autoantigen 1; ICAp69; p69; islet cell autoantigen p69; 69 kDa islet cell autoantigen; islet cell autoantigen 1 isoform; diabetes mellitus type I autoantigen; ICA69; |
| Gene ID | 3382 |
| mRNA Refseq | NM_001136020 |
| Protein Refseq | NP_001129492 |
| MIM | 147625 |
| UniProt ID | Q05084 |
| ◆ Recombinant Proteins | ||
| ICA1-4402M | Recombinant Mouse ICA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ICA1-2183R | Recombinant Rhesus monkey ICA1 Protein, His-tagged | +Inquiry |
| ICA1-828Z | Recombinant Zebrafish ICA1 | +Inquiry |
| ICA1-6160H | Recombinant Human ICA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ICA1-2762H | Recombinant Human ICA1 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICA1-5316HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
| ICA1-5315HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICA1 Products
Required fields are marked with *
My Review for All ICA1 Products
Required fields are marked with *
