Recombinant Human ICA1 protein, GST-tagged
Cat.No. : | ICA1-28632TH |
Product Overview : | Recombinant Human ICA1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-110 a.a. |
Description : | This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ICA1 islet cell autoantigen 1, 69kDa [ Homo sapiens ] |
Official Symbol | ICA1 |
Synonyms | ICA1; islet cell autoantigen 1, 69kDa; islet cell autoantigen 1 (69kD); islet cell autoantigen 1; ICAp69; p69; islet cell autoantigen p69; 69 kDa islet cell autoantigen; islet cell autoantigen 1 isoform; diabetes mellitus type I autoantigen; ICA69; |
Gene ID | 3382 |
mRNA Refseq | NM_022307 |
Protein Refseq | NP_071682 |
MIM | 147625 |
UniProt ID | Q05084 |
Chromosome Location | 7p22 |
Pathway | Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem; |
Function | molecular_function; protein domain specific binding; |
◆ Recombinant Proteins | ||
ICA1-2763H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
ICA1-3708H | Recombinant Human ICA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ICA1-3060H | Recombinant Human ICA1 protein, His-tagged | +Inquiry |
ICA1-1418H | Recombinant Human ICA1 Protein (1-268 aa), His-tagged | +Inquiry |
ICA1-0012H | Recombinant Human ICA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICA1-5315HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
ICA1-5316HCL | Recombinant Human ICA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICA1 Products
Required fields are marked with *
My Review for All ICA1 Products
Required fields are marked with *