Recombinant Human ICAM4 Protein, His-tagged

Cat.No. : ICAM4-061H
Product Overview : Recombinant Human ICAM4 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.
Molecular Mass : ~28 kDa
AA Sequence : MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens (human) ]
Official Symbol ICAM4
Synonyms ICAM4; intercellular adhesion molecule 4 (Landsteiner-Wiener blood group); intercellular adhesion molecule 4 (LW blood group) , intercellular adhesion molecule 4, Landsteiner Wiener blood group , Landsteiner Wiener blood group , LW; intercellular adhesion molecule 4; CD242; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group); LW;
Gene ID 3386
mRNA Refseq NM_001039132
Protein Refseq NP_001034221
MIM 614088
UniProt ID Q14773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ICAM4 Products

Required fields are marked with *

My Review for All ICAM4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon