Recombinant Human ICAM4 Protein, His-tagged
Cat.No. : | ICAM4-061H |
Product Overview : | Recombinant Human ICAM4 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. |
Molecular Mass : | ~28 kDa |
AA Sequence : | MALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTA |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens (human) ] |
Official Symbol | ICAM4 |
Synonyms | ICAM4; intercellular adhesion molecule 4 (Landsteiner-Wiener blood group); intercellular adhesion molecule 4 (LW blood group) , intercellular adhesion molecule 4, Landsteiner Wiener blood group , Landsteiner Wiener blood group , LW; intercellular adhesion molecule 4; CD242; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group); LW; |
Gene ID | 3386 |
mRNA Refseq | NM_001039132 |
Protein Refseq | NP_001034221 |
MIM | 614088 |
UniProt ID | Q14773 |
◆ Recombinant Proteins | ||
ICAM4-1130H | Recombinant Human ICAM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ICAM4-061H | Recombinant Human ICAM4 Protein, His-tagged | +Inquiry |
ICAM4-2169H | Recombinant Human ICAM4 protein, hFc-tagged | +Inquiry |
ICAM4-4077H | Recombinant Human ICAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ICAM4-1357HFL | Recombinant Full Length Human ICAM4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICAM4-943HCL | Recombinant Human ICAM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICAM4 Products
Required fields are marked with *
My Review for All ICAM4 Products
Required fields are marked with *
0
Inquiry Basket