Recombinant Human ICOSLG protein, His-tagged

• Cat.No.: ICOSLG-3349H
• Product Overview: Recombinant Human ICOSLG protein(1-302 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-302 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens ]
• Official Symbol: ICOSLG
• Synonyms: ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L
• Gene ID: 23308
• mRNA Refseq: NM_015259
• Protein Refseq: NP_056074
• MIM: 605717
• UniProt ID: O75144