Recombinant Human ICOSLG protein, His-tagged
| Cat.No. : | ICOSLG-3349H |
| Product Overview : | Recombinant Human ICOSLG protein(1-302 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-302 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens ] |
| Official Symbol | ICOSLG |
| Synonyms | ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L; |
| Gene ID | 23308 |
| mRNA Refseq | NM_015259 |
| Protein Refseq | NP_056074 |
| MIM | 605717 |
| UniProt ID | O75144 |
| ◆ Recombinant Proteins | ||
| ICOSLG-152H | Recombinant Human ICOSLG Protein, His-tagged | +Inquiry |
| ICOSLG-2933R | Active Recombinant Rat ICOSLG protein, Fc-tagged | +Inquiry |
| ICOSLG-1027H | Active Recombinant Human ICOSLG Protein, His-tagged | +Inquiry |
| ICOSLG-0119H | Recombinant Human ICOSLG Protein (Met1-Ser258), C-His-tagged | +Inquiry |
| ICOSLG-2934C | Active Recombinant Cynomolgus ICOSLG protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICOSLG-2618MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
| ICOSLG-1095HCL | Recombinant Human ICOSLG cell lysate | +Inquiry |
| ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICOSLG Products
Required fields are marked with *
My Review for All ICOSLG Products
Required fields are marked with *
