Recombinant Human ICT1 protein, His-SUMO-tagged
| Cat.No. : | ICT1-4369H |
| Product Overview : | Recombinant Human ICT1 protein(Q14197)(30-206aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-206aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.4 kDa |
| AA Sequence : | LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ICT1 immature colon carcinoma transcript 1 [ Homo sapiens ] |
| Official Symbol | ICT1 |
| Synonyms | ICT1; immature colon carcinoma transcript 1; peptidyl-tRNA hydrolase ICT1, mitochondrial; DS 1; digestion substraction 1; immature colon carcinoma transcript 1 protein; DS1; DS-1; |
| Gene ID | 3396 |
| mRNA Refseq | NM_001545 |
| Protein Refseq | NP_001536 |
| MIM | 603000 |
| UniProt ID | Q14197 |
| ◆ Recombinant Proteins | ||
| ICT1-4369H | Recombinant Human ICT1 protein, His-SUMO-tagged | +Inquiry |
| ICT1-7978M | Recombinant Mouse ICT1 Protein | +Inquiry |
| ICT1-395H | Recombinant Human immature colon carcinoma transcript 1, His-tagged | +Inquiry |
| ICT1-4405M | Recombinant Mouse ICT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICT1-5313HCL | Recombinant Human ICT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICT1 Products
Required fields are marked with *
My Review for All ICT1 Products
Required fields are marked with *
