Recombinant Human ID1 protein, His-SUMO-tagged
Cat.No. : | ID1-3062H |
Product Overview : | Recombinant Human ID1 protein(P41134)(1-155aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-155aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ID1 inhibitor of DNA binding 1, dominant negative helix-loop-helix protein [ Homo sapiens ] |
Official Symbol | ID1 |
Synonyms | ID1; inhibitor of DNA binding 1, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-1; bHLHb24; dJ857M17.1.2; DNA binding protein inhibitor ID 1; inhibitor of differentiation 1; class B basic helix-loop-helix protein 24; dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein); ID; |
Gene ID | 3397 |
mRNA Refseq | NM_002165 |
Protein Refseq | NP_002156 |
MIM | 600349 |
UniProt ID | P41134 |
◆ Recombinant Proteins | ||
ID1-531H | Recombinant Human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, His-tagged | +Inquiry |
ID1-3062H | Recombinant Human ID1 protein, His-SUMO-tagged | +Inquiry |
ID1-14041H | Recombinant Human ID1, GST-tagged | +Inquiry |
ID1-532HFL | Recombinant Full Length Human ID1 Protein, C-Flag-tagged | +Inquiry |
Id1-1207M | Recombinant Mouse Id1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ID1-5312HCL | Recombinant Human ID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ID1 Products
Required fields are marked with *
My Review for All ID1 Products
Required fields are marked with *