Recombinant Human IDH1 protein, His-tagged

• Cat.No.: IDH1-14047H
• Product Overview: Recombinant Human IDH1 protein(341-414 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 341-414 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: AHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: IDH1 isocitrate dehydrogenase 1 (NADP+), soluble [ Homo sapiens ]
• Official Symbol: IDH1
• Synonyms: IDH1; isocitrate dehydrogenase 1 (NADP+), soluble; isocitrate dehydrogenase [NADP] cytoplasmic; NADP(+)-specific ICDH; oxalosuccinate decarboxylase; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; IDH; IDP; IDCD; IDPC; PICD
• Gene ID: 3417
• mRNA Refseq: NM_005896
• Protein Refseq: NP_005887
• MIM: 147700
• UniProt ID: O75874