Recombinant Human IDH2 protein, His-tagged
| Cat.No. : | IDH2-2835H |
| Product Overview : | Recombinant Human IDH2 protein(104-452 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 104-452 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ] |
| Official Symbol | IDH2 |
| Synonyms | IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; NADP(+)-specific ICDH; oxalosuccinate decarboxylase; IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH; |
| Gene ID | 3418 |
| mRNA Refseq | NM_002168 |
| Protein Refseq | NP_002159 |
| MIM | 147650 |
| UniProt ID | P48735 |
| ◆ Recombinant Proteins | ||
| IDH2-14048H | Recombinant Human IDH2, GST-tagged | +Inquiry |
| Idh2-3472M | Recombinant Mouse Idh2 Protein, Myc/DDK-tagged | +Inquiry |
| IDH2-2192R | Recombinant Rhesus monkey IDH2 Protein, His-tagged | +Inquiry |
| IDH2-2986R | Recombinant Rat IDH2 Protein | +Inquiry |
| IDH2-2013R | Recombinant Rhesus Macaque IDH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IDH2-5306HCL | Recombinant Human IDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDH2 Products
Required fields are marked with *
My Review for All IDH2 Products
Required fields are marked with *
