Recombinant Human IDH2 protein, His-tagged
Cat.No. : | IDH2-2835H |
Product Overview : | Recombinant Human IDH2 protein(104-452 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 104-452 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IDH2 isocitrate dehydrogenase 2 (NADP+), mitochondrial [ Homo sapiens ] |
Official Symbol | IDH2 |
Synonyms | IDH2; isocitrate dehydrogenase 2 (NADP+), mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; NADP(+)-specific ICDH; oxalosuccinate decarboxylase; IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH; |
Gene ID | 3418 |
mRNA Refseq | NM_002168 |
Protein Refseq | NP_002159 |
MIM | 147650 |
UniProt ID | P48735 |
◆ Recombinant Proteins | ||
IDH2-9967Z | Recombinant Zebrafish IDH2 | +Inquiry |
IDH2-116H | Recombinant Human IDH2(R140Q) Protein, His-tagged | +Inquiry |
IDH2-118H | Recombinant Human IDH2 Protein, His-tagged | +Inquiry |
IDH2-3098H | Recombinant Human IDH2 Protein (Ala40-Gln452), N-His tagged | +Inquiry |
IDH2-14048H | Recombinant Human IDH2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH2-5306HCL | Recombinant Human IDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH2 Products
Required fields are marked with *
My Review for All IDH2 Products
Required fields are marked with *
0
Inquiry Basket