Recombinant Human IDH3G protein, His-SUMO-tagged
| Cat.No. : | IDH3G-3064H |
| Product Overview : | Recombinant Human IDH3G protein(P51553)(40-393aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 40-393aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.8 kDa |
| AA Sequence : | FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ] |
| Official Symbol | IDH3G |
| Synonyms | IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; IDH-gamma; NAD+-specific ICDH; NAD(+)-specific ICDH subunit gamma; isocitric dehydrogenase subunit gamma; NAD (H)-specific isocitrate dehydrogenase gamma subunit; isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit; H-IDHG; |
| Gene ID | 3421 |
| mRNA Refseq | NM_004135 |
| Protein Refseq | NP_004126 |
| MIM | 300089 |
| UniProt ID | P51553 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDH3G Products
Required fields are marked with *
My Review for All IDH3G Products
Required fields are marked with *
