Recombinant Human IDH3G protein, His-SUMO-tagged

Cat.No. : IDH3G-3064H
Product Overview : Recombinant Human IDH3G protein(P51553)(40-393aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 40-393aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.8 kDa
AA Sequence : FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ]
Official Symbol IDH3G
Synonyms IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; IDH-gamma; NAD+-specific ICDH; NAD(+)-specific ICDH subunit gamma; isocitric dehydrogenase subunit gamma; NAD (H)-specific isocitrate dehydrogenase gamma subunit; isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit; H-IDHG;
Gene ID 3421
mRNA Refseq NM_004135
Protein Refseq NP_004126
MIM 300089
UniProt ID P51553

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IDH3G Products

Required fields are marked with *

My Review for All IDH3G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon