Recombinant Human IDH3G protein, His-SUMO-tagged
Cat.No. : | IDH3G-3064H |
Product Overview : | Recombinant Human IDH3G protein(P51553)(40-393aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 40-393aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.8 kDa |
AA Sequence : | FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ] |
Official Symbol | IDH3G |
Synonyms | IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; IDH-gamma; NAD+-specific ICDH; NAD(+)-specific ICDH subunit gamma; isocitric dehydrogenase subunit gamma; NAD (H)-specific isocitrate dehydrogenase gamma subunit; isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit; H-IDHG; |
Gene ID | 3421 |
mRNA Refseq | NM_004135 |
Protein Refseq | NP_004126 |
MIM | 300089 |
UniProt ID | P51553 |
◆ Recombinant Proteins | ||
IDH3G-3064H | Recombinant Human IDH3G protein, His-SUMO-tagged | +Inquiry |
IDH3G-7988M | Recombinant Mouse IDH3G Protein | +Inquiry |
IDH3G-28079TH | Recombinant Human IDH3G | +Inquiry |
IDH3G-1324H | Recombinant Human Isocitrate Dehydrogenase 3 (NAD+) Gamma, His-tagged | +Inquiry |
IDH3G-2471Z | Recombinant Zebrafish IDH3G | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH3G-5302HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
IDH3G-5303HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDH3G Products
Required fields are marked with *
My Review for All IDH3G Products
Required fields are marked with *