Recombinant Human IER5 protein, GST-tagged
Cat.No. : | IER5-1235H |
Product Overview : | Recombinant Human IER5 protein(237 - 318 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 237 - 318 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | TPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPVLRDMN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IER5 immediate early response 5 [ Homo sapiens ] |
Official Symbol | IER5 |
Synonyms | IER5; immediate early response 5; |
Gene ID | 30015 |
◆ Recombinant Proteins | ||
IER5-8766H | Recombinant Human IER5 protein, GST-tagged | +Inquiry |
IER5-1663Z | Recombinant Zebrafish IER5 | +Inquiry |
IER5-4421M | Recombinant Mouse IER5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IER5-7999M | Recombinant Mouse IER5 Protein | +Inquiry |
IER5-3872H | Recombinant Human IER5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IER5-835HCL | Recombinant Human IER5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IER5 Products
Required fields are marked with *
My Review for All IER5 Products
Required fields are marked with *
0
Inquiry Basket