Recombinant Human IFI30 protein, His-tagged
| Cat.No. : | IFI30-3785H |
| Product Overview : | Recombinant Human IFI30 protein(3-261 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3-261 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IFI30 interferon, gamma-inducible protein 30 [ Homo sapiens ] |
| Official Symbol | IFI30 |
| Synonyms | IFI30; interferon, gamma-inducible protein 30; GILT; IP30; IFI-30; gamma-interferon-inducible lysosomal thiol reductase; legumaturain; gamma-interferon-inducible protein IP-30; interferon gamma-inducible protein 30 preproprotein; MGC32056; EC 1.8; Legumaturain |
| Gene ID | 10437 |
| mRNA Refseq | NM_006332 |
| Protein Refseq | NP_006323 |
| MIM | 604664 |
| UniProt ID | P13284 |
| ◆ Recombinant Proteins | ||
| IFI30-14061H | Recombinant Human IFI30, GST-tagged | +Inquiry |
| IFI30-2993R | Recombinant Rat IFI30 Protein | +Inquiry |
| IFI30-3427H | Recombinant Human IFI30 Protein (Met1-Lys250), N-His tagged | +Inquiry |
| IFI30-1317H | Recombinant Human IFI30 protein, His & T7-tagged | +Inquiry |
| IFI30-755H | Recombinant Human IFI30 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFI30-1503HCL | Recombinant Human IFI30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI30 Products
Required fields are marked with *
My Review for All IFI30 Products
Required fields are marked with *
