Recombinant Human IFI44 protein, His-tagged
| Cat.No. : | IFI44-3060H |
| Product Overview : | Recombinant Human IFI44 protein(9-175 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 9-175 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | RLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQEGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | IFI44 interferon-induced protein 44 [ Homo sapiens ] |
| Official Symbol | IFI44 |
| Synonyms | IFI44; interferon-induced protein 44; MTAP44; p44; microtubule-associated protein 44; interferon-induced, hepatitis C-associated microtubular aggregate protein (44kD); |
| Gene ID | 10561 |
| mRNA Refseq | NM_006417 |
| Protein Refseq | NP_006408 |
| MIM | 610468 |
| UniProt ID | Q8TCB0 |
| ◆ Recombinant Proteins | ||
| IFI44-3728H | Recombinant Human IFI44 protein, GST-tagged | +Inquiry |
| IFI44-2653H | Recombinant Human IFI44 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IFI44-8011M | Recombinant Mouse IFI44 Protein | +Inquiry |
| IFI44-3060H | Recombinant Human IFI44 protein, His-tagged | +Inquiry |
| IFI44-3119H | Recombinant Human IFI44 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFI44-5292HCL | Recombinant Human IFI44 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI44 Products
Required fields are marked with *
My Review for All IFI44 Products
Required fields are marked with *
