Recombinant Human IFITM3 protein, His-tagged
Cat.No. : | IFITM3-524H |
Product Overview : | Recombinant Human IFITM3 protein(NP_066362)(1-133 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-133 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IFITM3 interferon induced transmembrane protein 3 [ Homo sapiens ] |
Official Symbol | IFITM3 |
Synonyms | IFITM3; interferon induced transmembrane protein 3; interferon induced transmembrane protein 3 (1 8U); interferon-induced transmembrane protein 3; 1 8U; interferon-inducible protein 1-8U; 1-8U; IP15; |
Gene ID | 10410 |
mRNA Refseq | NM_021034 |
Protein Refseq | NP_066362 |
MIM | 605579 |
UniProt ID | Q01628 |
◆ Recombinant Proteins | ||
IFITM3-1873H | Recombinant Human IFITM3 protein, His-tagged | +Inquiry |
RFL12797RF | Recombinant Full Length Rat Interferon-Induced Transmembrane Protein 3(Ifitm3) Protein, His-Tagged | +Inquiry |
IFITM3-8020M | Recombinant Mouse IFITM3 Protein | +Inquiry |
IFITM3-26285H | Recombinant Human IFITM3, mFc-tagged | +Inquiry |
IFITM3-2649R | Recombinant Rat IFITM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFITM3-1529HCL | Recombinant Human IFITM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFITM3 Products
Required fields are marked with *
My Review for All IFITM3 Products
Required fields are marked with *
0
Inquiry Basket