Recombinant Human IFITM3 protein, His-tagged

• Cat.No.: IFITM3-524H
• Product Overview: Recombinant Human IFITM3 protein(NP_066362)(1-133 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-133 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IFITM3 interferon induced transmembrane protein 3 [ Homo sapiens ]
• Official Symbol: IFITM3
• Synonyms: IFITM3; interferon induced transmembrane protein 3; interferon induced transmembrane protein 3 (1 8U); interferon-induced transmembrane protein 3; 1 8U; interferon-inducible protein 1-8U; 1-8U; IP15
• Gene ID: 10410
• mRNA Refseq: NM_021034
• Protein Refseq: NP_066362
• MIM: 605579
• UniProt ID: Q01628